PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G19790.1
Common NameF6F9.16, SRS7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SRS
Protein Properties Length: 345aa    MW: 37928.4 Da    PI: 6.6647
Description SHI-related sequence 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G19790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702231.51.4e-711132722154
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa........aeaaskrkrelkskkqsalsstkl 91 
                  r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWv+aakrrerq+qla + +k+ ++a        +++++++++++++   sal++t++
  AT1G19790.1 113 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAKRRERQAQLAVLPAKRIRDAnsrgggddDDDDKEDEKNDSCGGGSALACTRV 210
                  7899*****************************************************999998887789999877777888888899*********** PP

       DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  ++a+s+  lets+lP+e+ss+avfrc+rvss+dd++ee+aYqtavsigGhvfkGiLydqG+++
  AT1G19790.1 211 VNASSS-GLETSHLPPEISSPAVFRCMRVSSIDDEDEEYAYQTAVSIGGHVFKGILYDQGPSS 272
                  **9765.99***************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.2E-63116271IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.0E-27118160IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.8E-27222270IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009299Biological ProcessmRNA transcription
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009851Biological Processauxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAGLFYLGGR DHNKQDHHQE KDHNEDKSNN YLYLYKDEIY NNNKGFEIFP PQYFQQQQQQ  60
NHAAAPTNLY SFGMVPSGGN INNNRSTNRS LYFNVVSDHE PVRSSTGGFT VTRQGNMNCQ  120
DCGNQAKKDC PHMRCRTCCK SRGFDCQTHV KSTWVSAAKR RERQAQLAVL PAKRIRDANS  180
RGGGDDDDDD KEDEKNDSCG GGSALACTRV VNASSSGLET SHLPPEISSP AVFRCMRVSS  240
IDDEDEEYAY QTAVSIGGHV FKGILYDQGP SSDHHRYSSS LNGETSHQHH LNLMDSTPSA  300
ATTNAVTAVN TNNGSIDPSS LYTAVATPFN AFVAGGTPFF ASSRC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.511770.0flower| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G19790
AtGenExpressAT1G19790
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In young plants, detected at a low level only in the root tips and lateral root primordia. In fully open flowers, primarily observed in the filaments and anthers. {ECO:0000269|PubMed:20706774}.
UniprotTISSUE SPECIFICITY: Mainly expressed in the filaments of flowers, the shoot apex regions and pollen. Also present in leaves. {ECO:0000269|PubMed:20706774}.
Functional Description ? help Back to Top
Source Description
TAIRA member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis.
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Regulates anther dehiscence and floral development. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:20706774}.
Function -- GeneRIF ? help Back to Top
  1. Mutations within SRS7 cause disrupted anther dehiscence and abnormal floral organ development in addition to dwarfed growth with small, curled leaves.
    [PMID: 20706774]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G19790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:20706774}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G19790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9246760.0AY924676.1 Arabidopsis thaliana hypothetical protein (At1g19790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031069.10.0SHI-related sequence 7 protein
RefseqNP_173409.10.0SHI-related sequence 7 protein
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD7KI570.0D7KI57_ARALL; Putative uncharacterized protein
STRINGAT1G19790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Representative plantOGRP18721140
Publications ? help Back to Top
  1. Fridborg I,Kuusk S,Robertson M,Sundberg E
    The Arabidopsis protein SHI represses gibberellin responses in Arabidopsis and barley.
    Plant Physiol., 2001. 127(3): p. 937-48
    [PMID:11706176]
  2. Kuusk S,Sohlberg JJ,Long JA,Fridborg I,Sundberg E
    STY1 and STY2 promote the formation of apical tissues during Arabidopsis gynoecium development.
    Development, 2002. 129(20): p. 4707-17
    [PMID:12361963]
  3. Xiao YL, et al.
    Analysis of the cDNAs of hypothetical genes on Arabidopsis chromosome 2 reveals numerous transcript variants.
    Plant Physiol., 2005. 139(3): p. 1323-37
    [PMID:16244158]
  4. Kuusk S,Sohlberg JJ,Magnus Eklund D,Sundberg E
    Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.
    Plant J., 2006. 47(1): p. 99-111
    [PMID:16740146]
  5. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  6. Kim SG, et al.
    Activation tagging of an Arabidopsis SHI-RELATED SEQUENCE gene produces abnormal anther dehiscence and floral development.
    Plant Mol. Biol., 2010. 74(4-5): p. 337-51
    [PMID:20706774]
  7. Eklund DM, et al.
    Expression of Arabidopsis SHORT INTERNODES/STYLISH family genes in auxin biosynthesis zones of aerial organs is dependent on a GCC box-like regulatory element.
    Plant Physiol., 2011. 157(4): p. 2069-80
    [PMID:21976484]
  8. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]